PDB entry 1goe

View 1goe on RCSB PDB site
Description: Monitoring the structural Consequences of Phe12-->D-Phe12 and Leu15-->Aib15 substitution in h/r Corticotropin Releasing Hormone: Implications for Design of CRH antagonists.
Class: hormone
Keywords: hormone, corticotropin releasing hormone, synthetic analogues, solid phase synthesis, solutions structure
Deposited on 2001-10-20, released 2001-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: corticotropin releasing hormone
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06850 (0-40)
      • engineered mutation (11)
      • engineered mutation (14)
    Domains in SCOPe 2.08: d1goea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1goeA (A:)
    seeppisldltfhlarevlemaraeqlaqqahsnrklmeii