PDB entry 1god

View 1god on RCSB PDB site
Description: monomeric lys-49 phospholipase a2 homologue isolated from the venom of cerrophidion (bothrops) godmani
Class: hydrolase
Keywords: lys49-phospholipase a2, snake venom, bothrops
Deposited on 1999-04-16, released 1999-04-23
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.188
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (phospholipase a2)
  Species: Cerrophidion godmani
  Database cross-references and differences (RAF-indexed):
  • Uniprot P81165 (0-110)
  Domains in SCOP 1.73: d1goda_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1godA (A:)
  smyqlwkmilqetgknavpsyglygcncgvgsrgkpkdatdrccfvhkccykkltdcspk
  tdsysyswkdktivcgdnnpclqemcecdkavaiclrenldtynknykiypkplckkada
  c