PDB entry 1god

View 1god on RCSB PDB site
Description: monomeric lys-49 phospholipase a2 homologue isolated from the venom of cerrophidion (bothrops) godmani
Deposited on 1999-04-16, released 1999-04-23
The last revision prior to the SCOP 1.69 freeze date was dated 2000-04-24, with a file datestamp of 2000-04-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.188
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1goda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1godA (A:)
    smyqlwkmilqetgknavpsyglygcncgvgsrgkpkdatdrccfvhkccykkltdcspk
    tdsysyswkdktivcgdnnpclqemcecdkavaiclrenldtynknykiypkplckkada
    c