PDB entry 1god

View 1god on RCSB PDB site
Description: monomeric lys-49 phospholipase a2 homologue isolated from the venom of cerrophidion (bothrops) godmani
Class: hydrolase
Keywords: lys49-phospholipase a2, snake venom, bothrops, hydrolase
Deposited on 1999-04-16, released 1999-04-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.188
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (phospholipase a2)
    Species: Cerrophidion godmani [TaxId:44722]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1goda_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1godA (A:)
    smyqlwkmilqetgknavpsyglygcncgvgsrgkpkdatdrccfvhkccykkltdcspk
    tdsysyswkdktivcgdnnpclqemcecdkavaiclrenldtynknykiypkplckkada
    c