PDB entry 1gob

View 1gob on RCSB PDB site
Description: cooperative stabilization of escherichia coli ribonuclease hi by insertion of gly-80b and gly-77-> ala substitution
Class: hydrolase(endoribonuclease)
Keywords: hydrolase(endoribonuclease)
Deposited on 1993-05-10, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ribonuclease H
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7Y4 (0-154)
    • conflict (76)
  Domains in SCOPe 2.07: d1goba_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gobA (A:)
  mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
  ehcevilstdsqyvrqaitqwihnwkkrgwktadkkpvknvdlwqrldaalgqhqikwew
  vkghaghpenercdelaraaamnptledtgyqvev