PDB entry 1go5

View 1go5 on RCSB PDB site
Description: Structure of the C-terminal FG-binding domain of human Tap
Class: nuclear transport
Keywords: nuclear transport, mRNA export, uba, nucleoporins
Deposited on 2001-10-18, released 2002-02-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tip associating protein
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UBU9 (0-68)
  Domains in SCOPe 2.08: d1go5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1go5A (A:)
  paptpssspvptlspeqqemlqafstqsgmnlewsqkclqdnnwdytrsaqafthlkakg
  eipevafmk