PDB entry 1go4

View 1go4 on RCSB PDB site
Description: Crystal structure of Mad1-Mad2 reveals a conserved Mad2 binding motif in Mad1 and Cdc20.
Class: cell cycle
Keywords: mitotic spindle checkpoint, cell cycle, mitosis, nuclear pro
Deposited on 2001-10-17, released 2002-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitotic spindle assembly checkpoint protein mad2a
    Species: Homo sapiens [TaxId:9606]
    Gene: MAD2L1, MAD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13257
      • engineered mutation (132)
    Domains in SCOPe 2.08: d1go4a_
  • Chain 'B':
    Compound: mitotic spindle assembly checkpoint protein mad2a
    Species: Homo sapiens [TaxId:9606]
    Gene: MAD2L1, MAD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13257
      • engineered mutation (132)
    Domains in SCOPe 2.08: d1go4b_
  • Chain 'C':
    Compound: mitotic spindle assembly checkpoint protein mad2a
    Species: Homo sapiens [TaxId:9606]
    Gene: MAD2L1, MAD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13257
      • engineered mutation (132)
    Domains in SCOPe 2.08: d1go4c_
  • Chain 'D':
    Compound: mitotic spindle assembly checkpoint protein mad2a
    Species: Homo sapiens [TaxId:9606]
    Gene: MAD2L1, MAD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13257
      • engineered mutation (132)
    Domains in SCOPe 2.08: d1go4d_
  • Chain 'E':
    Compound: Mitotic spindle assembly checkpoint protein MAD1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAD1L1, MAD1, TXBP181
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1go4e_
  • Chain 'F':
    Compound: Mitotic spindle assembly checkpoint protein MAD1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAD1L1, MAD1, TXBP181
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1go4f_
  • Chain 'G':
    Compound: Mitotic spindle assembly checkpoint protein MAD1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAD1L1, MAD1, TXBP181
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1go4g_
  • Chain 'H':
    Compound: Mitotic spindle assembly checkpoint protein MAD1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAD1L1, MAD1, TXBP181
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1go4h_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1go4A (A:)
    malqlsreqgitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdle
    likylnnvveqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreks
    qkaiqdeirsviaqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnsee
    vrlrsftttihkvnsmvaykipvnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1go4A (A:)
    eqgitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnn
    vveqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreksqkaiqde
    irsviaqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsft
    ttihkvnsmvaykipv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1go4B (B:)
    malqlsreqgitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdle
    likylnnvveqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreks
    qkaiqdeirsviaqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnsee
    vrlrsftttihkvnsmvaykipvnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1go4B (B:)
    gitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnvv
    eqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreksqkaiqdeir
    sviaqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsfttt
    ihkvnsmvaykipvn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1go4C (C:)
    malqlsreqgitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdle
    likylnnvveqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreks
    qkaiqdeirsviaqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnsee
    vrlrsftttihkvnsmvaykipvnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1go4C (C:)
    gitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnvv
    eqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreksqkaiqdeir
    sviaqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsfttt
    ihkvnsmvaykipvn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1go4D (D:)
    malqlsreqgitlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdle
    likylnnvveqlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreks
    qkaiqdeirsviaqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnsee
    vrlrsftttihkvnsmvaykipvnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1go4D (D:)
    itlrgsaeivaeffsfginsilyqrgiypsetftrvqkygltllvttdlelikylnnvve
    qlkdwlykcsvqklvvvisniesgevlerwqfdiecdktakddsapreksqkaiqdeirs
    viaqitatvtflpllevscsfdlliytdkdlvvpekweesgpqfitnseevrlrsfttti
    hkvnsmvaykipv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1go4E (E:)
    ssaeqsflfsreeadtlrlkveelegersrleeekrmleaqlerralqgdydqsrtkvlh
    mslnptsvarqrlredhsqlqaecerlrgllramerggtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1go4E (E:)
    fsreeadtlrlkveelegersrleeekrmleaqlerralqgdydqsrtkvlhmslnptsv
    arqrlredhsqlqaecerlrgllrame
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1go4F (F:)
    ssaeqsflfsreeadtlrlkveelegersrleeekrmleaqlerralqgdydqsrtkvlh
    mslnptsvarqrlredhsqlqaecerlrgllramerggtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1go4F (F:)
    fsreeadtlrlkveelegersrleeekrmleaqlerralqgdydqsrtkvlhmslnptsv
    arqrlredhsqlqaecerlrgllrame
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1go4G (G:)
    ssaeqsflfsreeadtlrlkveelegersrleeekrmleaqlerralqgdydqsrtkvlh
    mslnptsvarqrlredhsqlqaecerlrgllramerggtv
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1go4H (H:)
    ssaeqsflfsreeadtlrlkveelegersrleeekrmleaqlerralqgdydqsrtkvlh
    mslnptsvarqrlredhsqlqaecerlrgllramerggtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1go4H (H:)
    aeqsflfsreeadtlrlkveelegersrleeekrmleaqlerralqgdydqsrtkvlhms
    lnptsvarqrlredhsqlqaecerlrgllrame