PDB entry 1go3

View 1go3 on RCSB PDB site
Description:
Deposited on 2001-10-17, released 2001-12-07
The last revision prior to the SCOP 1.69 freeze date was dated 2001-12-07, with a file datestamp of 2001-12-07.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.217
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1go3e1, d1go3e2
  • Chain 'F':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1go3f_
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1go3m1, d1go3m2
  • Chain 'N':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1go3n_

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1go3E (E:)
    mykileiadvvkvppeefgkdlketvkkilmekyegrldkdvgfvlsivdvkdigegkvv
    hgdgsayhpvvfetlvyipemyeliegevvdvvefgsfvrlgpldglihvsqimddyvsy
    dpkreaiigketgkvleigdyvrarivaislkaerkrgskialtmrqpylgklewieeek
    akkqnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1go3E (E:)
    mykileiadvvkvppeefgkdlketvkkilmekyegrldkdvgfvlsivdvkdigegkvv
    hgdgsayhpvvfetlvyipemyeliegevvdvvefgsfvrlgpldglihvsqimddyvsy
    dpkaiigketgkvleigdyvrarivaislkaskialtmrqpylgklewieeekakkq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1go3F (F:)
    migkkilgeryvtvseaaeimynraqigelsyeqgcaldylqkfakldkeeakklveeli
    slgidektavkiadilpedlddlraiyykrelpenaeeileivrkyi
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1go3M (M:)
    mykileiadvvkvppeefgkdlketvkkilmekyegrldkdvgfvlsivdvkdigegkvv
    hgdgsayhpvvfetlvyipemyeliegevvdvvefgsfvrlgpldglihvsqimddyvsy
    dpkreaiigketgkvleigdyvrarivaislkaerkrgskialtmrqpylgklewieeek
    akkqnqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1go3M (M:)
    mykileiadvvkvppeefgkdlketvkkilmekyegrldkdvgfvlsivdvkdigegkvv
    hgdgsayhpvvfetlvyipemyeliegevvdvvefgsfvrlgpldglihvsqimddyvsy
    dpkreaiigketgkvleigdyvrarivaislskialtmrqpylgklewieeeka
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1go3N (N:)
    migkkilgeryvtvseaaeimynraqigelsyeqgcaldylqkfakldkeeakklveeli
    slgidektavkiadilpedlddlraiyykrelpenaeeileivrkyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1go3N (N:)
    igkkilgeryvtvseaaeimynraqigelsyeqgcaldylqkfakldkeeakklveelis
    lgidektavkiadilpedlddlraiyykrelpenaeeileivrkyi