PDB entry 1go2

View 1go2 on RCSB PDB site
Description: structure of ferredoxin-nadp+ reductase with lys 72 replaced by glu (k72e)
Class: oxidoreductase
Keywords: oxidoreductase, flavoprotein, fnr, electron transport
Deposited on 2001-10-15, released 2002-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.22
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin--nadp+ reductase
    Species: NOSTOC SP. [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21890 (Start-303)
      • engineered mutation (72)
    Domains in SCOPe 2.06: d1go2a1, d1go2a2
  • Heterogens: FAD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1go2A (A:)
    mtqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqs
    igiippgvdkngepeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcst
    ylthiepgsevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanp
    eyqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdr
    vaehadqlwqliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwh
    vety
    

    Sequence, based on observed residues (ATOM records): (download)
    >1go2A (A:)
    dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
    kngepeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
    evkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfsw
    lvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadqlw
    qliknqkthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety