PDB entry 1gnz

View 1gnz on RCSB PDB site
Description: lectin I-b4 from griffonia simplicifolia (gs I-b4)metal free form
Class: lectin
Keywords: lectin, glycoprotein
Deposited on 2001-10-11, released 2001-11-29
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.228
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Griffonia simplicifolia
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1gnza_
  • Heterogens: NAG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gnzA (A:)
    qsdsvsftfpnfwsdvedsiifqgdanttagtlqlcktnqygtplqwsagralysdpvql
    wdnktesvasfyteftfflkitgngpadglafflappdsdvkdageylglfnkstatqps
    knqvvavefdtwtnpnfpepsyrhiginvnsivsvatkrwedsdifsgkiatarisydgs
    aeiltvvlsypdgsdyilshsvdmrqnlpesvrvgisastgnnqfltvyilswrfssnlq
    stsvkaamepeitrtvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gnzA (A:)
    svsftfpnfwsdvedsiifqgdanttagtlqlcktnqygtplqwsagralysdpvqlwdn
    ktesvasfyteftfflkitgngpadglafflappdsdvkdageylglfnkstatqpsknq
    vvavefdtwtnpnfpepsyrhiginvnsivsvatkrwedsdifsgkiatarisydgsaei
    ltvvlsypdgsdyilshsvdmrqnlpesvrvgisastgnnqfltvyilswrfssnl