PDB entry 1gny

View 1gny on RCSB PDB site
Description: xylan-binding module cbm15
Deposited on 2001-10-10, released 2001-11-29
The last revision prior to the SCOP 1.71 freeze date was dated 2003-02-28, with a file datestamp of 2003-02-28.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: 0.15164
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1gnya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnyA (A:)
    gnvvievdmangwrgnasgstshsgitysadgvtfaalgdgvgavfdiarpttledavia
    mvvnvsaefkaseanlqifaqlkedwskgewdclagsseltadtdltltctidedddkfn
    qtardvqvgiqakgtpagtitiksvtitlaqea