PDB entry 1gny

View 1gny on RCSB PDB site
Description: xylan-binding module CBM15
Class: carbohydrate-binding module
Keywords: carbohydrate-binding module, xylan, xylooligosaccharide, xylanase, catalysis
Deposited on 2001-10-10, released 2001-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase 10c
    Species: PSEUDOMONAS CELLULOSA [TaxId:155077]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gnya_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnyA (A:)
    gnvvievdmangwrgnasgstshsgitysadgvtfaalgdgvgavfdiarpttledavia
    mvvnvsaefkaseanlqifaqlkedwskgewdclagsseltadtdltltctidedddkfn
    qtardvqvgiqakgtpagtitiksvtitlaqea