PDB entry 1gnx

View 1gnx on RCSB PDB site
Description: b-glucosidase from Streptomyces sp
Class: hydrolase
Keywords: hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase
Deposited on 2001-10-10, released 2002-10-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Streptomyces sp. [TaxId:1931]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59976
      • conflict (142)
      • conflict (149)
      • conflict (245)
    Domains in SCOPe 2.08: d1gnxa_
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: Streptomyces sp. [TaxId:1931]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59976 (Start-478)
      • conflict (142)
      • conflict (149)
      • conflict (245)
    Domains in SCOPe 2.08: d1gnxb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gnxA (A:)
    mvpaaqqtatapdaaltfpegflwgsatasyqiegaaaedgrtpsiwdtyartpgrvrng
    dtgdvatdhyhrwredvalmaelglgayrfslawpriqptgrgpalqkgldfyrrladel
    lakgiqpvatlyhwdlpqelenaggwperataerfaeyaaiaadalgdrvktwttlnepw
    csaflgygsgvhapgrtdpvaalraahhlnlghglavqalrdrlpadaqcsvtlnihhvr
    pltdsdadadavrridalanrvftgpmlqgaypedlvkdtagltdwsfvrdgdlrlahqk
    ldflgvnyysptlvseadgsgthnsdghgrsahspwpgadrvafhqppgettamgwavdp
    sglyellrrlssdfpalplvitengaafhdyadpegnvndperiayvrdhlaavhraikd
    gsdvrgyflwslldnfewahgyskrfgavyvdyptgtripkasarwyaevartgvlpta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gnxA (A:)
    altfpegflwgsatasyqiegaaaedgrtpsiwdtyartpgrvrngdtgdvatdhyhrwr
    edvalmaelglgayrfslawpriqptgrgpalqkgldfyrrladellakgiqpvatlyhw
    dlpqelenaggwperataerfaeyaaiaadalgdrvktwttlnepwcsaflgygsgvhap
    grtdpvaalraahhlnlghglavqalrdrlpadaqcsvtlnihhvrpltdsdadadavrr
    idalanrvftgpmlqgaypedlvkdtagltdwsfvrdgdlrlahqkldflgvnyysptlv
    sahspwpgadrvafhqppgettamgwavdpsglyellrrlssdfpalplvitengaafhd
    yadpegnvndperiayvrdhlaavhraikdgsdvrgyflwslldnfewahgyskrfgavy
    vdyptgtripkasarwyaevartgvlpt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gnxB (B:)
    mvpaaqqtatapdaaltfpegflwgsatasyqiegaaaedgrtpsiwdtyartpgrvrng
    dtgdvatdhyhrwredvalmaelglgayrfslawpriqptgrgpalqkgldfyrrladel
    lakgiqpvatlyhwdlpqelenaggwperataerfaeyaaiaadalgdrvktwttlnepw
    csaflgygsgvhapgrtdpvaalraahhlnlghglavqalrdrlpadaqcsvtlnihhvr
    pltdsdadadavrridalanrvftgpmlqgaypedlvkdtagltdwsfvrdgdlrlahqk
    ldflgvnyysptlvseadgsgthnsdghgrsahspwpgadrvafhqppgettamgwavdp
    sglyellrrlssdfpalplvitengaafhdyadpegnvndperiayvrdhlaavhraikd
    gsdvrgyflwslldnfewahgyskrfgavyvdyptgtripkasarwyaevartgvlpta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gnxB (B:)
    altfpegflwgsatasyqiegaaaedgrtpsiwdtyartpgrvrngdtgdvatdhyhrwr
    edvalmaelglgayrfslawpriqptgrgpalqkgldfyrrladellakgiqpvatlyhw
    dlpqelenaggwperataerfaeyaaiaadalgdrvktwttlnepwcsaflgygsgvhap
    grtdpvaalraahhlnlghglavqalrdrlpadaqcsvtlnihhvrpltdsdadadavrr
    idalanrvftgpmlqgaypedlvkdtagltdwsfvrdgdlrlahqkldflgvnyysptlv
    shspwpgadrvafhqppgettamgwavdpsglyellrrlssdfpalplvitengaafhdy
    adpegnvndperiayvrdhlaavhraikdgsdvrgyflwslldnfewahgyskrfgavyv
    dyptgtripkasarwyaevartgvlpta