PDB entry 1gnu

View 1gnu on RCSB PDB site
Description: gaba(a) receptor associated protein gabarap
Class: transport
Keywords: transport, ubiquitin-like, receptor
Deposited on 2001-10-09, released 2001-12-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.203
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gabarap
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gnua_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnuA (A:)
    mkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvgqf
    yflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl