PDB entry 1gnn

View 1gnn on RCSB PDB site
Description: hiv-1 protease mutant with val 82 replaced by asn (v82n) complexed with u89360e (inhibitor)
Class: hydrolase (acid protease)
Keywords: aspartic protease, hiv, mutant, inhibitor, u-89360e, hydrolase (acid protease)
Deposited on 1996-05-04, released 1996-11-08
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.183
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03368 (0-98)
      • engineered (81)
    Domains in SCOPe 2.03: d1gnna_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03368 (0-98)
      • engineered (81)
    Domains in SCOPe 2.03: d1gnnb_
  • Heterogens: U0E, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnnA (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpnniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnnB (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpnniigrnlltqigctlnf