PDB entry 1gnn

View 1gnn on RCSB PDB site
Description: hiv-1 protease mutant with val 82 replaced by asn (v82n) complexed with u89360e (inhibitor)
Deposited on 1996-05-04, released 1996-11-08
The last revision prior to the SCOP 1.71 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.183
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1gnna_
  • Chain 'B':
    Domains in SCOP 1.71: d1gnnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gnnA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpnniigrnlltqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gnnB (B:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpnniigrnlltqigctlnf