PDB entry 1gnm

View 1gnm on RCSB PDB site
Description: hiv-1 protease mutant with val 82 replaced by asp (v82d) complexed with u89360e (inhibitor)
Deposited on 1996-05-04, released 1996-11-08
The last revision prior to the SCOP 1.69 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.175
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1gnma_
  • Chain 'B':
    Domains in SCOP 1.69: d1gnmb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gnmA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpdniigrnlltqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gnmB (B:)
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpdniigrnlltqigctlnf