PDB entry 1gnk

View 1gnk on RCSB PDB site
Description: glnk, a signal protein from e. coli
Deposited on 1998-07-14, released 1999-07-23
The last revision prior to the SCOP 1.71 freeze date was dated 1999-07-23, with a file datestamp of 1999-07-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1gnka_
  • Chain 'B':
    Domains in SCOP 1.71: d1gnkb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gnkA (A:)
    mklvtviikpfkledvrealssigiqgltvtevkgfgrqkghaelyrgaeysvnflpkvk
    idvaiaddqldevidivskaaytgkigdgkifvaelqrvirirtgeadeaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gnkA (A:)
    mklvtviikpfkledvrealssigiqgltvtevkgfgrvnflpkvkidvaiaddqldevi
    divskaaytgkigdgkifvaelqrvirirtgeadeaal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnkB (B:)
    mklvtviikpfkledvrealssigiqgltvtevkgfgrqkghaelyrgaeysvnflpkvk
    idvaiaddqldevidivskaaytgkigdgkifvaelqrvirirtgeadeaal