PDB entry 1gnh

View 1gnh on RCSB PDB site
Description: human c-reactive protein
Deposited on 1996-03-01, released 1997-01-27
The last revision prior to the SCOP 1.57 freeze date was dated 1997-01-27, with a file datestamp of 1997-01-27.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.239
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1gnha_
  • Chain 'B':
    Domains in SCOP 1.57: d1gnhb_
  • Chain 'C':
    Domains in SCOP 1.57: d1gnhc_
  • Chain 'D':
    Domains in SCOP 1.57: d1gnhd_
  • Chain 'E':
    Domains in SCOP 1.57: d1gnhe_
  • Chain 'F':
    Domains in SCOP 1.57: d1gnhf_
  • Chain 'G':
    Domains in SCOP 1.57: d1gnhg_
  • Chain 'H':
    Domains in SCOP 1.57: d1gnhh_
  • Chain 'I':
    Domains in SCOP 1.57: d1gnhi_
  • Chain 'J':
    Domains in SCOP 1.57: d1gnhj_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnhA (A:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnhB (B:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnhC (C:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnhD (D:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnhE (E:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnhF (F:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnhG (G:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnhH (H:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnhI (I:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gnhJ (J:)
    qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
    neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
    lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
    spnvlnwralkyevqgevftkpqlwp