PDB entry 1gnf

View 1gnf on RCSB PDB site
Description: solution structure of the n-terminal zinc finger of murine gata-1, nmr, 25 structures
Class: transcription regulation
Keywords: zinc finger, transcription regulation
Deposited on 1998-10-12, released 1999-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcription factor gata-1
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17679 (0-45)
    • cloning artifact (0-1)
  Domains in SCOPe 2.08: d1gnfa1, d1gnfa2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gnfA (A:)
  gsearecvncgatatplwrrdrtghylcnacglyhkmngqnrplir