PDB entry 1gne

View 1gne on RCSB PDB site
Description: the three-dimensional structure of glutathione s-transferase of schistosoma japonicum fused with a conserved neutralizing epitope on gp41 of human immunodeficiency virus type 1
Class: transferase
Keywords: glutathione transferase
Deposited on 1994-06-16, released 1994-11-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: glutathione s-transferase
  Species: synthetic construct, synthetic [TaxId:32630]
  Gene: GP41
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08515 (0-216)
  Domains in SCOPe 2.01: d1gnea1, d1gnea2
• Heterogens: GSW, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gneA (A:)
  spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
  dvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkvd
  flsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkk
  rieaipqidkylksskyiawplqgwqatfgggdhppksdlvprgsmeldkwa