PDB entry 1gne

View 1gne on RCSB PDB site
Description: the three-dimensional structure of glutathione s-transferase of schistosoma japonicum fused with a conserved neutralizing epitope on gp41 of human immunodeficiency virus type 1
Class: transferase
Keywords: glutathione transferase, transferase
Deposited on 1994-06-16, released 1994-11-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: synthetic construct, synthetic [TaxId:32630]
    Gene: GP41
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gnea1, d1gnea2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gneA (A:)
    spilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyidg
    dvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkvd
    flsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkk
    rieaipqidkylksskyiawplqgwqatfgggdhppksdlvprgsmeldkwa