PDB entry 1gn5

View 1gn5 on RCSB PDB site
Description: refined structure of the gene 5 /dna$ binding protein from bacteriophage $fd
Deposited on 1984-11-16, released 1985-04-01
The last revision was dated 1986-01-21, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >1gn5_ (-)
    mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgneypvlvkitldegqpayapgl
    ytvhlssfkvgqfgslmidrlrlvpak
    

  • Chain 'p':
    No sequence available.