PDB entry 1gn4

View 1gn4 on RCSB PDB site
Description: H145E mutant of Mycobacterium tuberculosis iron-superoxide dismutase.
Class: oxidoreductase
Keywords: oxidoreductase, iron
Deposited on 2001-10-02, released 2001-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gn4a1, d1gn4a2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gn4b1, d1gn4b2
  • Chain 'C':
    Compound: superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gn4c1, d1gn4c2
  • Chain 'D':
    Compound: superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gn4d1, d1gn4d2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gn4A (A:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgsgwaalgwdtlgnkllifqvydeqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gn4A (A:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gsgwaalgwdtlgnkllifqvydeqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gn4B (B:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgsgwaalgwdtlgnkllifqvydeqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gn4B (B:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gsgwaalgwdtlgnkllifqvydeqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gn4C (C:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgsgwaalgwdtlgnkllifqvydeqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gn4C (C:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gsgwaalgwdtlgnkllifqvydeqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gn4D (D:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgsgwaalgwdtlgnkllifqvydeqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gn4D (D:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gsgwaalgwdtlgnkllifqvydeqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats