PDB entry 1gn3

View 1gn3 on RCSB PDB site
Description: h145q mutant of mycobacterium tuberculosis iron-superoxide dismutase.
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2001-10-02, released 2001-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-01, with a file datestamp of 2009-08-28.
Experiment type: XRAY
Resolution: 4 Å
R-factor: 0.168
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17670
      • engineered mutation (144)
    Domains in SCOPe 2.07: d1gn3a1, d1gn3a2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17670
      • engineered mutation (144)
    Domains in SCOPe 2.07: d1gn3b1, d1gn3b2
  • Heterogens: FE

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gn3A (A:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgsgwaalgwdtlgnkllifqvydqqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gn3A (A:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gsgwaalgwdtlgnkllifqvydqqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gn3B (B:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgsgwaalgwdtlgnkllifqvydqqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gn3B (B:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gsgwaalgwdtlgnkllifqvydqqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats