PDB entry 1gn2

View 1gn2 on RCSB PDB site
Description: s123c mutant of the iron-superoxide dismutase from mycobacterium tuberculosis.
Class: oxidoreductase
Keywords: oxidoreductase, iron
Deposited on 2001-10-02, released 2001-10-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.249
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gn2a1, d1gn2a2
  • Chain 'B':
    Compound: superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gn2b1, d1gn2b2
  • Chain 'C':
    Compound: superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gn2c1, d1gn2c2
  • Chain 'D':
    Compound: superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gn2d1, d1gn2d2
  • Chain 'E':
    Compound: superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gn2e1, d1gn2e2
  • Chain 'F':
    Compound: superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gn2f1, d1gn2f2
  • Chain 'G':
    Compound: superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gn2g1, d1gn2g2
  • Chain 'H':
    Compound: superoxide dismutase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gn2h1, d1gn2h2
  • Heterogens: FE

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gn2A (A:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gn2A (A:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gn2B (B:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gn2B (B:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gn2C (C:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gn2C (C:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gn2D (D:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gn2D (D:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1gn2E (E:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gn2E (E:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1gn2F (F:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gn2F (F:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1gn2G (G:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gn2G (G:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1gn2H (H:)
    maeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsail
    lneknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattv
    qgcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfaka
    fwnvvnwadvqsryaaatsqtkglifg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gn2H (H:)
    aeytlpdldwdygalephisgqinelhhskhhatyvkgandavakleearakedhsaill
    neknlafnlaghvnhtiwwknlspnggdkptgelaaaiadafgsfdkfraqfhaaattvq
    gcgwaalgwdtlgnkllifqvydhqtnfplgivplllldmwehafylqyknvkvdfakaf
    wnvvnwadvqsryaaats