PDB entry 1gn0

View 1gn0 on RCSB PDB site
Description: Escherichia coli GlpE sulfurtransferase soaked with KCN
Class: transferase
Keywords: transferase, rhodanese, sulfurtransferase, glycerol metabolism
Deposited on 2001-10-01, released 2001-11-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.17715
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thiosulfate sulfurtransferase glpe
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gn0a_
  • Heterogens: NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gn0A (A:)
    mdqfecinvadahqklqekeavlvdirdpqsfamghavqafhltndtlgafmrdndfdtp
    vmvmcyhgnsskgaaqyllqqgydvvysidggfeawqrqfpaevayga