PDB entry 1gmx

View 1gmx on RCSB PDB site
Description: Escherichia coli GlpE sulfurtransferase
Class: transferase
Keywords: transferase, rhodanese, sulfurtransferase, glycerol metabolism
Deposited on 2001-09-25, released 2001-11-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-08-01, with a file datestamp of 2012-07-27.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.12832
AEROSPACI score: 0.94 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thiosulfate sulfurtransferase glpe
    Species: ESCHERICHIA COLI [TaxId:469008]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1gmxa_
  • Heterogens: ACT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gmxA (A:)
    mdqfecinvadahqklqekeavlvdirdpqsfamghavqafhltndtlgafmrdndfdtp
    vmvmcyhgnsskgaaqyllqqgydvvysidggfeawqrqfpaevayga