PDB entry 1gmr

View 1gmr on RCSB PDB site
Description: complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution
Class: hydrolase(guanyloribonuclease)
Keywords: hydrolase(guanyloribonuclease)
Deposited on 1992-10-01, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.146
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ribonuclease sa
  Species: Streptomyces aureofaciens
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05798 (0-95)
  Domains in SCOP 1.75: d1gmra_
• Chain 'B':
  Compound: ribonuclease sa
  Species: Streptomyces aureofaciens
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05798 (0-95)
  Domains in SCOP 1.75: d1gmrb_
• Heterogens: SO4, 2GP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gmrA (A:)
  dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
  gartrgtrriicgeatqedyytgdhyatfslidqtc
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gmrB (B:)
  dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
  gartrgtrriicgeatqedyytgdhyatfslidqtc