PDB entry 1gmr
View 1gmr on RCSB PDB site
Description: complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution
Class: hydrolase(guanyloribonuclease)
Keywords: hydrolase(guanyloribonuclease)
Deposited on
1992-10-01, released
1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated
1993-10-31, with a file datestamp of
2007-06-04.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.146
AEROSPACI score: 0.65
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: ribonuclease sa
Species: Streptomyces aureofaciens
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1gmra_ - Chain 'B':
Compound: ribonuclease sa
Species: Streptomyces aureofaciens
Database cross-references and differences (RAF-indexed):
Domains in SCOP 1.75: d1gmrb_ - Heterogens: SO4, 2GP, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1gmrA (A:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriicgeatqedyytgdhyatfslidqtc
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1gmrB (B:)
dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
gartrgtrriicgeatqedyytgdhyatfslidqtc