PDB entry 1gmq

View 1gmq on RCSB PDB site
Description: complex of ribonuclease from streptomyces aureofaciens with 2'-gmp at 1.7 angstroms resolution
Class: hydrolase(guanyloribonuclease)
Keywords: hydrolase(guanyloribonuclease)
Deposited on 1992-10-01, released 1993-10-31
The last revision prior to the SCOP 1.75 freeze date was dated 1993-10-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.139
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease sa
    Species: Streptomyces aureofaciens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gmqa_
  • Chain 'B':
    Compound: ribonuclease sa
    Species: Streptomyces aureofaciens
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gmqb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gmqA (A:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriicgeatqedyytgdhyatfslidqtc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gmqB (B:)
    dvsgtvclsalppeatdtlnliasdgpfpysqdgvvfqnresvlptqsygyyheytvitp
    gartrgtrriicgeatqedyytgdhyatfslidqtc