PDB entry 1gmm

View 1gmm on RCSB PDB site
Description: carbohydrate binding module cbm6 from xylanase u clostridium thermocellum
Class: xylanase
Keywords: xylanase, carbohydrate binding module, cbm family 6, xylan binding
Deposited on 2001-09-19, released 2001-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.20809
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cbm6
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gmma_
  • Heterogens: SO4, NA, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gmmA (A:)
    rsafskieseeynslksstiqtigtsdggsgigyiesgdylvfnkinfgngansfkarva
    sgadtptniqlrlgsptgtligtltvastggwnnyeekscsitnttgqhdlylvfsgpvn
    idyfifdsngvnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gmmA (A:)
    fskieseeynslksstiqtigtsdggsgigyiesgdylvfnkinfgngansfkarvasga
    dtptniqlrlgsptgtligtltvastggwnnyeekscsitnttgqhdlylvfsgpvnidy
    fifdsn