PDB entry 1gmg

View 1gmg on RCSB PDB site
Description: alanine 31 proline mutant of rop protein, monoclinic form
Class: transcription regulation
Keywords: transcription regulation
Deposited on 2001-09-13, released 2002-09-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: -1.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein rop
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03051 (0-End)
      • engineered mutation (30)
    Domains in SCOPe 2.08: d1gmga_
  • Chain 'B':
    Compound: Regulatory protein rop
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03051
      • engineered mutation (30)
    Domains in SCOPe 2.08: d1gmgb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gmgA (A:)
    mtkqektalnmarfirsqtltlleklneldpdeqadiceslhdhadelyrsclarfgddg
    enl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gmgA (A:)
    mtkqektalnmarfirsqtltlleklneldpdeqadiceslhdhadelyrsclarf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gmgB (B:)
    mtkqektalnmarfirsqtltlleklneldpdeqadiceslhdhadelyrsclarfgddg
    enl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gmgB (B:)
    kqektalnmarfirsqtltlleklneldpdeqadiceslhdhadelyrsclarf