PDB entry 1gm5

View 1gm5 on RCSB PDB site
Description: structure of recg bound to three-way DNA junction
Class: helicase
Keywords: helicase, replication restart
Deposited on 2001-09-11, released 2001-10-03
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.24 Å
R-factor: 0.275
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: recg
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1gm5a1, d1gm5a2, d1gm5a3, d1gm5a4
  • Chain 'X':
    Compound: DNA (5'-(*cp*ap*gp*cp*tp*cp*cp*ap*tp*gp*ap*tp* cp*ap*tp*tp*gp*gp*cp*a)-3')
  • Chain 'Y':
    Compound: DNA (5'-(*gp*cp*ap*gp*tp*gp*cp*tp*cp*gp*cp*ap* tp*gp*gp*ap*gp*cp*tp*g)-3')
  • Chain 'Z':
    Compound: DNA (5'-(*gp*ap*gp*cp*ap*cp*tp*gp*c)-3')
  • Heterogens: ADP, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gm5A (A:)
    mlcsryftsslflwgealptlleeflnevekmlknqvntrrihqllkelddpllenkdle
    eklqafldyvkeipnlpearkryriqkslemieklrswflidylecsgeevdlstdiqya
    kgvgpnrkkklkklgietlrdlleffprdyedrrkifklndllpgekvttqgkivsvetk
    kfqnmniltavlsdglvhvplkwfnqdylqtylkqltgkevfvtgtvksnaytgqyeihn
    aevtpkegeyvrrilpiyrltsgisqkqmrkifeenipslccslketlperilekrkllg
    vkdayygmhfpktfyhlekarerlayeelfvlqlafqkirkerekhggipkkiegklaee
    fikslpfkltnaqkrahqeirndmisekpmnrllqgdvgsgktvvaqlaildnyeagfqt
    afmvptsilaiqhyrrtvesfskfnihvalligattpsekekiksglrngqidvvigtha
    liqedvhfknlglviideqhrfgvkqrealmnkgkmvdtlvmsatpiprsmalafygdld
    vtvidemppgrkevqtmlvpmdrvnevyefvrqevmrggqafivyplieesdklnvksav
    emyeylskevfpefklglmhgrlsqeekdrvmlefaegrydilvsttvievgidvpranv
    mvienperfglaqlhqlrgrvgrggqeaycflvvgdvgeeamerlrfftlntdgfkiaey
    dlktrgpgeffgvkqhglsgfkvadlyrdlkllewaredvqeidvegielpeeiklievg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gm5A (A:)
    ftsslflwgealptlleeflnevekmlknqvntrrihqllkelddpllenkdleeklqaf
    ldyvkeipnlpearkryriqkslemieklrswflidylecsgeevdlstdiqyakgvgpn
    rkkklkklgietlrdlleffprdyedrrkifklndllpgekvttqgkivsvetkkfqnmn
    iltavlsdglvhvplkwfnqdylqtylkqltgkevfvtgtvksnaytgqyeihnaevtpk
    egeyvrrilpiyrltsgisqkqmrkifeenipslccslketlperilekrkllgvkdayy
    gmhfpktfyhlekarerlayeelfvlqlafqkirkerekhggipkkiegklaeefikslp
    fkltnaqkrahqeirndmisekpmnrllqgdvgsgktvvaqlaildnyeagfqtafmvpt
    silaiqhyrrtvesfskfnihvalligattpsekekiksglrngqidvvigthaliqedv
    hfknlglviideqhrfealmnkgkmvdtlvmsatpiprsmalafygdldvtvidemppgr
    kevqtmlvpmdrvnevyefvrqevmrggqafivypliksavemyeylskevfklglmhgr
    lsqeekdrvmlefaegrydilvsttvievgidvpranvmvienperfglaqlhqlrgrvg
    rggqeaycflvvgdvgeeamerlrfftlntdgfkiaeydlktrgpgekqhglsgfkvadl
    yrdlkllew
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.