PDB entry 1gm4

View 1gm4 on RCSB PDB site
Description: OXIDISED STRUCTURE OF CYTOCHROME C3 FROM DESULFOVIBRIO DESULFURICANS ATCC 27774 at pH 7.6
Class: electron transport
Keywords: electron transport, cytochrome
Deposited on 2001-09-10, released 2002-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio desulfuricans [TaxId:876]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9L915 (0-106)
      • conflict (70)
    Domains in SCOPe 2.07: d1gm4a_
  • Heterogens: HEC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gm4A (A:)
    apavpdkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg
    ekslyyvvhargelkhtsclachskvvaekpelkkdltgcakskchp