PDB entry 1gm3

View 1gm3 on RCSB PDB site
Description: structural characterisation of a monoclonal antibody specific for the pres1 region of the hepatitis b virus
Class: immunoglobulin
Keywords: antibody fab fragment
Deposited on 2001-09-09, released 2002-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2002-09-12, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.194
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: immunoglobulin heavy chain
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • PDB 1GM3 (0-End)
    Domains in SCOPe 2.07: d1gm3h1, d1gm3h2
  • Chain 'L':
    Compound: immunoglobulin light chain
    Species: Mus musculus
    Domains in SCOPe 2.07: d1gm3l1, d1gm3l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gm3H (H:)
    evqlvesggglvkpggslklscaasgftfssyamswvrqspekrlewvaevssdgsyayy
    pdtltgrftisrdnakntlylemtslrsedtamyycasfnwdvaywgqgtlvtvsaaktt
    ppsvyplapgslaqtnsmvtlgclvkgyfpepvtvtwnsgslsssgvhtfpavlqsdlyt
    lsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1gm3L (L:)
    divmtqspsslavsvgekvtmscrssqsllntrtrksylawfqqkpgqspkmliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsyslytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnecevqlvesggglvkpggslkls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gm3L (L:)
    divmtqspsslavsvgekvtmscrssqsllntrtrksylawfqqkpgqspkmliywastr
    esgvpdrftgsgsgtdftltissvqaedlavyyckqsyslytfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec