PDB entry 1gm1

View 1gm1 on RCSB PDB site
Description: Second PDZ Domain (PDZ2) of PTP-BL
Class: hydrolase
Keywords: pdz, ptp-bl, fas interaction, lim interaction, structural protein, cytoskeleton, hydrolase
Deposited on 2001-09-06, released 2002-03-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein tyrosine phosphatase
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q64512 (0-93)
  Domains in SCOPe 2.08: d1gm1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gm1A (A:)
  kpgdtfevelaktdgslgisvtggvntsvrhggiyvkaiipkgaaesdgrihkgdrvlav
  ngvslegathkqavetlrntgqvvhlllekgqvp