PDB entry 1gm0

View 1gm0 on RCSB PDB site
Description: a form of the pheromone-binding protein from bombyx mori
Class: transport protein
Keywords: transport protein, insect odorant-binding protein, ph-dependent conformation, helical insertion
Deposited on 2001-09-05, released 2001-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-13.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pheromone-binding protein
  Species: BOMBYX MORI [TaxId:7091]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P34174 (0-141)
  Domains in SCOPe 2.07: d1gm0a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gm0A (A:)
  sqevmknlslnfgkaldeckkemtltdainedfynfwkegyeiknretgcaimclstkln
  mldpegnlhhgnamefakkhgadetmaqqlidivhgcekstpanddkciwtlgvatcfka
  eihklnwapsmdvavgeilaev