PDB entry 1glu

View 1glu on RCSB PDB site
Description: crystallographic analysis of the interaction of the glucocorticoid receptor with DNA
Class: transcription/DNA
Keywords: protein-DNA complex, double helix, transcription/DNA complex
Deposited on 1992-08-30, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.196
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glucocorticoid receptor)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06536 (2-80)
      • conflict (3-5)
    Domains in SCOPe 2.06: d1glua1, d1glua2
  • Chain 'B':
    Compound: protein (glucocorticoid receptor)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06536 (2-80)
      • conflict (3-5)
    Domains in SCOPe 2.06: d1glub1, d1glub2
  • Chain 'C':
    Compound: DNA (5'-d(*cp*cp*ap*gp*ap*ap*cp*ap*tp*cp*gp*ap*tp*gp*tp*tp*c p*tp*g)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*cp*cp*ap*gp*ap*ap*cp*ap*tp*cp*gp*ap*tp*gp*tp*tp*c p*tp*g)-3')
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gluA (A:)
    mkparpclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncp
    acryrkclqagmnlearktkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gluB (B:)
    mkparpclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncp
    acryrkclqagmnlearktkk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.