PDB entry 1glu

View 1glu on RCSB PDB site
Description: crystallographic analysis of the interaction of the glucocorticoid receptor with DNA
Class: transcription/DNA
Keywords: protein-DNA complex, double helix, transcription/DNA complex
Deposited on 1992-08-30, released 1994-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.196
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (glucocorticoid receptor)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06536 (2-80)
    • conflict (3-5)
  Domains in SCOPe 2.08: d1glua1, d1glua2
• Chain 'B':
  Compound: protein (glucocorticoid receptor)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06536 (2-80)
    • conflict (3-5)
  Domains in SCOPe 2.08: d1glub1, d1glub2
• Chain 'C':
  Compound: DNA (5'-d(*cp*cp*ap*gp*ap*ap*cp*ap*tp*cp*gp*ap*tp*gp*tp*tp*c p*tp*g)-3')
  
• Chain 'D':
  Compound: DNA (5'-d(*cp*cp*ap*gp*ap*ap*cp*ap*tp*cp*gp*ap*tp*gp*tp*tp*c p*tp*g)-3')
  
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gluA (A:)
  mkparpclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncp
  acryrkclqagmnlearktkk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gluB (B:)
  mkparpclvcsdeasgchygvltcgsckvffkravegqhnylcagrndciidkirrkncp
  acryrkclqagmnlearktkk
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.