PDB entry 1glo

View 1glo on RCSB PDB site
Description: Crystal Structure of Cys25Ser mutant of human cathepsin S
Class: hydrolase
Keywords: cathepsin s, proteinase, inhibitor, hydrolase, thiol proteas
Deposited on 2001-08-31, released 2002-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25774 (0-216)
      • engineered mutation (24)
      • conflict (46)
      • conflict (96)
    Domains in SCOPe 2.08: d1gloa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gloA (A:)
lpdsvdwrekgcvtevkyqgscgaswafsavgaleaqlklktgklvslsaqnlvdcstek
ygnkgcnggfmttafqyiidnkgidsdasypykamdlkcqydskyraatcskytelpygr
edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
lvknswghnfgeegyirmarnkgnhcgiasfpsypei