PDB entry 1gln

View 1gln on RCSB PDB site
Description: architectures of class-defining and specific domains of glutamyl-tRNA synthetase
Class: aminoacyl-tRNA synthase
Keywords: RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, AMINOACYL-TRNA SYNTHASE
Deposited on 1994-07-20, released 1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1glna1, d1glna2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1glnA (A:)
    mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal
    kwlglsydegpdvaaptgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg
    gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk
    sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd
    ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl
    ggpvfdleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfd
    tlkefpekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfa
    aekgvklgqvaqplraaltgsletpglfeilallgkeralrrlerala