PDB entry 1glh

View 1glh on RCSB PDB site
Description: cation binding to a bacillus (1,3-1,4)-beta-glucanase. geometry, affinity and effect on protein stability
Class: hydrolase
Keywords: hydrolase
Deposited on 1994-11-25, released 1995-02-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,3-1,4-beta-glucanase
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1glha_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1glhA (A:)
    qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
    caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf
    nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
    mnlwngtgvddwlgsynganplyaeydwvkytsn