PDB entry 1glh

View 1glh on RCSB PDB site
Description: cation binding to a bacillus (1,3-1,4)-beta-glucanase. geometry, affinity and effect on protein stability
Deposited on 1994-11-25, released 1995-02-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: -
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1glh__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1glh_ (-)
qtggsffepfnsynsgtwekadgysnggvfnctwrannvnftndgklklgltssaynkfd
caeyrstniygyglyevsmkpakntgivssfftytgpahgtqwdeidieflgkdttkvqf
nyytngvgghekvislgfdaskgfhtyafdwqpgyikwyvdgvlkhtatanipstpgkim
mnlwngtgvddwlgsynganplyaeydwvkytsn