PDB entry 1glb

View 1glb on RCSB PDB site
Description: structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1992-10-28, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: GLUCOSE-SPECIFIC PROTEIN IIIGlc
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1glbf_
  • Chain 'G':
    Compound: glycerol kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1glbg1, d1glbg2
  • Heterogens: ADP, GOL

PDB Chain Sequences:

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1glbF (F:)
    glfdklkslvsddkkdtgtieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmv
    apvdgtigkifetnhafsiesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtvi
    efdlplleekakstltpvvisnmdeikeliklsgsvtvgetpvirikk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1glbF (F:)
    glfdklkslvsdtieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgt
    igkifetnhafsiesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlpl
    leekakstltpvvisnmdeikeliklsgsvtvgetpvirikk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1glbG (G:)
    tekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstl
    vevlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgl
    edyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhv
    tdytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripis
    giagdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevny
    alegavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpya
    rgaifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmq
    fqsdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgiettern
    yryagwkkavkramaweehde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1glbG (G:)
    kyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlvev
    lakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgledy
    irsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtdy
    tnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtnigipisgiagdqqaa
    lfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfma
    gasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltr
    gvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtr
    verpevrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkka
    vkramaweeh