PDB entry 1gl9

View 1gl9 on RCSB PDB site
Description: archaeoglobus fulgidus reverse gyrase complexed with adpnp
Class: topoisomerase
Keywords: topoisomerase, DNA supercoiling, archaea, helicase
Deposited on 2001-08-30, released 2002-02-11
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.256
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: reverse gyrase
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29238 (Start-1053)
      • engineered mutation (718)
      • engineered mutation (1045)
    Domains in SCOPe 2.01: d1gl9b1, d1gl9b2, d1gl9b3
  • Chain 'C':
    Compound: reverse gyrase
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29238 (Start-1053)
      • engineered mutation (718)
      • engineered mutation (1045)
    Domains in SCOPe 2.01: d1gl9c1, d1gl9c2, d1gl9c3
  • Heterogens: ANP, MG

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gl9B (B:)
    mipvvysnlcpvcggdleskeiekhvcfrkkrslclfpedfllkefveffrkcvgeprai
    qkmwakrilrkesfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetir
    kyaekagvgtenligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfif
    vddvdailkasknvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqll
    nfdigssritvrnvedvavndesistlssileklgtggiiyartgeeaeeiyeslknkfr
    igivtatkkgdyekfvegeidhligtahyygtlvrgldlperirfavfvgcpsfrvtied
    idslspqmvkllaylyrnvdeierllpaverhidevreilkkvmgkerpqakdvvvrege
    vifpdlrtyiqgsgrtsrlfaggltkgasflleddsellsafieraklydiefksidevd
    feklsreldesrdryrrrqefdlikpalfivesptkarqisrffgkpsvkvldgavvyei
    pmqkyvlmvtasighvvdlitnrgfhgvlvngrfvpvyasikrcrdcgyqftedrescpk
    cgsenvdnsrsriealrklahdaefvivgtdpdtegekiawdlknllsgcgavkraefhe
    vtrrailealeslrdvdenlvkaqvvrriedrwigfvlsqklwerfnnrnlsagraqtlv
    lgwiidrfqesrerrkiaivrdfdlvlehdeeefdltiklveereelrtplppyttetml
    sdanrilkfsvkqtmqiaqelfenglityhrtdstrvsdvgqriakeylgddfvgrewge
    sgahecirptrpltrddvqrliqegvlvveglrwehfalydlifrrfmasqcrpfkvvvk
    kysiefdgktaeeerivraegrayelyravwvknelptgtfrvkaevksvpkvlpftqse
    iiqmmkergigrpstyativdrlfmrnyvvekygrmiptklgidvfrflvrryakfvsed
    rtrdlesrmdaiergeldylkaledmyaeiksid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl9B (B:)
    ipvvypvcggleskeiekhkrslclfpedfllkefveffrkcvgepraiqkmwakrilrk
    esfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirkyaekagvgte
    nligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifvddvdailkas
    knvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqllnfdigssritv
    rnvedvavndesistlssileklgtggiiyartgeeaeeiyeslknkfrigivtatkkgd
    yekfvegeidhligtahyygtlvrgldlperirfavfvgcpsfrvtiedidslspqmvkl
    laylyrnvdeierllpaverhidevreilkkvmgkerpqakdvvvregevifpdlrtyiq
    gsgrtsrlfaggltkgasflleddsellsafieraklydiefksidevdfeklsreldes
    rdryrrrqefdlikpalfivesptkarqisrffgkpsvkvldgavvyeipmqkyvlmvta
    sighvvdlitnrgfhgvlvngrfvpvyasikvdnsrsriealrklahdaefvivgtdpdt
    egekiawdlknllsgcgavkraefhevtrrailealeslrdvdenlvkaqvvrriedrwi
    gfvlsqklwerfnnrnlsagraqtlvlgwiidrfqesrerrkiaivrdfdlvlehdeeef
    dltiklveereelrtplppyttetmlsdanrilkfsvkqtmqiaqelfenglityhrtds
    trvsdvgqriakeylgddfvgrewgesgahecirptrpltrddvqrliqegvlvveglrw
    ehfalydlifrrfmasqcrpfkvvvkkysiefdgktaeeerivraegrayelyravwvkn
    elptgtfrvkaevksvpkvlpftqseiiqmmkergigrpstyativdrlfmrnyvvekyg
    rmiptklgidvfrflvrryakfvsedrtrdlesrmdaiergeldylkaledmyaeiksid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gl9C (C:)
    mipvvysnlcpvcggdleskeiekhvcfrkkrslclfpedfllkefveffrkcvgeprai
    qkmwakrilrkesfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetir
    kyaekagvgtenligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfif
    vddvdailkasknvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqll
    nfdigssritvrnvedvavndesistlssileklgtggiiyartgeeaeeiyeslknkfr
    igivtatkkgdyekfvegeidhligtahyygtlvrgldlperirfavfvgcpsfrvtied
    idslspqmvkllaylyrnvdeierllpaverhidevreilkkvmgkerpqakdvvvrege
    vifpdlrtyiqgsgrtsrlfaggltkgasflleddsellsafieraklydiefksidevd
    feklsreldesrdryrrrqefdlikpalfivesptkarqisrffgkpsvkvldgavvyei
    pmqkyvlmvtasighvvdlitnrgfhgvlvngrfvpvyasikrcrdcgyqftedrescpk
    cgsenvdnsrsriealrklahdaefvivgtdpdtegekiawdlknllsgcgavkraefhe
    vtrrailealeslrdvdenlvkaqvvrriedrwigfvlsqklwerfnnrnlsagraqtlv
    lgwiidrfqesrerrkiaivrdfdlvlehdeeefdltiklveereelrtplppyttetml
    sdanrilkfsvkqtmqiaqelfenglityhrtdstrvsdvgqriakeylgddfvgrewge
    sgahecirptrpltrddvqrliqegvlvveglrwehfalydlifrrfmasqcrpfkvvvk
    kysiefdgktaeeerivraegrayelyravwvknelptgtfrvkaevksvpkvlpftqse
    iiqmmkergigrpstyativdrlfmrnyvvekygrmiptklgidvfrflvrryakfvsed
    rtrdlesrmdaiergeldylkaledmyaeiksid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl9C (C:)
    pvvyspvcggdleskeiekhrslclfpedfllkefveffrkcvgepraiqkmwakrilrk
    esfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirkyaekagvgte
    nligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifvddvdailkas
    knvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqllnfdigssritv
    rnvedvavndesistlssileklgtggiiyartgeeaeeiyeslknkfrigivtatkkgd
    yekfvegeidhligtahyygtlvrgldlperirfavfvgcpsfrvtiedidslspqmvkl
    laylyrnvdeierllevreimgkerpqakdvvvregevifpdlrtyiqgsgrtsrlfagg
    ltkgasflleddsellsafieraklydiefksidevdfeklsreldesrdryrrrqefdl
    ikpalfivesptkarqisrffgkpsvkvldgavvyeipmqkyvlmvtasighvvdlitnr
    gfhgvlvngrfvpvyasikrcrvdnsrsriealrklahdaefvivgtdpdtegekiawdl
    knllsgcgavkraefhevtrrailealeslrdvdenlvkaqvvrriedrwigfvlsqklw
    erfnnrnlsagraqtlvlgwiidrfqesrerrkiaivrdfdlvldeeefdltiklveere
    elrtplppyttetmlsdanrilkfsvkqtmqiaqelfenglityhrtdstrvsdvgqria
    keylgddfvgrewgesgahecirptrpltrddvqrliqegvlvveglrwehfalydlifr
    rfmasqcrpfkvvvkkysiefdeeerivraegrayelyravwvknelptgtfrvkaevks
    vpkvlpftqseiiqmmkergigrpstyativdrlfmrnyvvekygrmiptklgidvfrfl
    vrryakfvsedrtrdlesrmdaiergeldylkaledmyaeiksid