PDB entry 1gl9

View 1gl9 on RCSB PDB site
Description: archaeoglobus fulgidus reverse gyrase complexed with adpnp
Deposited on 2001-08-30, released 2002-02-11
The last revision prior to the SCOP 1.61 freeze date was dated 2002-02-11, with a file datestamp of 2002-02-11.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.256
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gl9B (B:)
    ipvvysnlcpvcggdleskeiekhvcfrkkrslclfpedfllkefveffrkcvgepraiq
    kmwakrilrkesfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirk
    yaekagvgtenligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifv
    ddvdailkasknvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqlln
    fdigssritvrnvedvavndesistlssileklgtggiiyartgeeaeeiyeslknkfri
    givtatkkgdyekfvegeidhligtahyygtlvrgldlperirfavfvgcpsfrvtiedi
    dslspqmvkllaylyrnvdeierllpaverhidevreilkkvmgkerpqakdvvvregev
    ifpdlrtyiqgsgrtsrlfaggltkgasflleddsellsafieraklydiefksidevdf
    eklsreldesrdryrrrqefdlikpalfivesptkarqisrffgkpsvkvldgavvyeip
    mqkyvlmvtasighvvdlitnrgfhgvlvngrfvpvyasikrcrdcgyqftedrescpkc
    gsenvdnsrsriealrklahdaefvivgtdpdtegekiawdlknllsgcgavkraefhev
    trrailealeslrdvdenlvkaqvvrriedrwigfvlsqklwerfnnrnlsagraqtlvl
    gwiidrfqesrerrkiaivrdfdlvlehdeeefdltiklveereelrtplppyttetmls
    danrilkfsvkqtmqiaqelfenglityhrtdstrvsdvgqriakeylgddfvgrewges
    gahecirptrpltrddvqrliqegvlvveglrwehfalydlifrrfmasqcrpfkvvvkk
    ysiefdgktaeeerivraegrayelyravwvknelptgtfrvkaevksvpkvlpftqsei
    iqmmkergigrpstyativdrlfmrnyvvekygrmiptklgidvfrflvrryakfvsedr
    trdlesrmdaiergeldylkaledmyaeiksid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl9B (B:)
    ipvvypvcggleskeiekhkrslclfpedfllkefveffrkcvgepraiqkmwakrilrk
    esfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirkyaekagvgte
    nligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifvddvdailkas
    knvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqllnfdigssritv
    rnvedvavndesistlssileklgtggiiyartgeeaeeiyeslknkfrigivtatkkgd
    yekfvegeidhligtahyygtlvrgldlperirfavfvgcpsfrvtiedidslspqmvkl
    laylyrnvdeierllpaverhidevreilkkvmgkerpqakdvvvregevifpdlrtyiq
    gsgrtsrlfaggltkgasflleddsellsafieraklydiefksidevdfeklsreldes
    rdryrrrqefdlikpalfivesptkarqisrffgkpsvkvldgavvyeipmqkyvlmvta
    sighvvdlitnrgfhgvlvngrfvpvyasikvdnsrsriealrklahdaefvivgtdpdt
    egekiawdlknllsgcgavkraefhevtrrailealeslrdvdenlvkaqvvrriedrwi
    gfvlsqklwerfnnrnlsagraqtlvlgwiidrfqesrerrkiaivrdfdlvlehdeeef
    dltiklveereelrtplppyttetmlsdanrilkfsvkqtmqiaqelfenglityhrtds
    trvsdvgqriakeylgddfvgrewgesgahecirptrpltrddvqrliqegvlvveglrw
    ehfalydlifrrfmasqcrpfkvvvkkysiefdgktaeeerivraegrayelyravwvkn
    elptgtfrvkaevksvpkvlpftqseiiqmmkergigrpstyativdrlfmrnyvvekyg
    rmiptklgidvfrflvrryakfvsedrtrdlesrmdaiergeldylkaledmyaeiksid
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gl9C (C:)
    pvvysnlcpvcggdleskeiekhvcfrkkrslclfpedfllkefveffrkcvgepraiqk
    mwakrilrkesfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirky
    aekagvgtenligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifvd
    dvdailkasknvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqllnf
    digssritvrnvedvavndesistlssileklgtggiiyartgeeaeeiyeslknkfrig
    ivtatkkgdyekfvegeidhligtahyygtlvrgldlperirfavfvgcpsfrvtiedid
    slspqmvkllaylyrnvdeierllpaverhidevreilkkvmgkerpqakdvvvregevi
    fpdlrtyiqgsgrtsrlfaggltkgasflleddsellsafieraklydiefksidevdfe
    klsreldesrdryrrrqefdlikpalfivesptkarqisrffgkpsvkvldgavvyeipm
    qkyvlmvtasighvvdlitnrgfhgvlvngrfvpvyasikrcrdcgyqftedrescpkcg
    senvdnsrsriealrklahdaefvivgtdpdtegekiawdlknllsgcgavkraefhevt
    rrailealeslrdvdenlvkaqvvrriedrwigfvlsqklwerfnnrnlsagraqtlvlg
    wiidrfqesrerrkiaivrdfdlvlehdeeefdltiklveereelrtplppyttetmlsd
    anrilkfsvkqtmqiaqelfenglityhrtdstrvsdvgqriakeylgddfvgrewgesg
    ahecirptrpltrddvqrliqegvlvveglrwehfalydlifrrfmasqcrpfkvvvkky
    siefdgktaeeerivraegrayelyravwvknelptgtfrvkaevksvpkvlpftqseii
    qmmkergigrpstyativdrlfmrnyvvekygrmiptklgidvfrflvrryakfvsedrt
    rdlesrmdaiergeldylkaledmyaeiksid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl9C (C:)
    pvvyspvcggdleskeiekhrslclfpedfllkefveffrkcvgepraiqkmwakrilrk
    esfaataptgvgktsfglamslflalkgkrcyvifptsllviqaaetirkyaekagvgte
    nligyyhgripkrekenfmqnlrnfkivitttqflskhyrelghfdfifvddvdailkas
    knvdkllhllgfhydlktkswvgeargclmvstatakkgkkaelfrqllnfdigssritv
    rnvedvavndesistlssileklgtggiiyartgeeaeeiyeslknkfrigivtatkkgd
    yekfvegeidhligtahyygtlvrgldlperirfavfvgcpsfrvtiedidslspqmvkl
    laylyrnvdeierllevreimgkerpqakdvvvregevifpdlrtyiqgsgrtsrlfagg
    ltkgasflleddsellsafieraklydiefksidevdfeklsreldesrdryrrrqefdl
    ikpalfivesptkarqisrffgkpsvkvldgavvyeipmqkyvlmvtasighvvdlitnr
    gfhgvlvngrfvpvyasikrcrvdnsrsriealrklahdaefvivgtdpdtegekiawdl
    knllsgcgavkraefhevtrrailealeslrdvdenlvkaqvvrriedrwigfvlsqklw
    erfnnrnlsagraqtlvlgwiidrfqesrerrkiaivrdfdlvldeeefdltiklveere
    elrtplppyttetmlsdanrilkfsvkqtmqiaqelfenglityhrtdstrvsdvgqria
    keylgddfvgrewgesgahecirptrpltrddvqrliqegvlvveglrwehfalydlifr
    rfmasqcrpfkvvvkkysiefdeeerivraegrayelyravwvknelptgtfrvkaevks
    vpkvlpftqseiiqmmkergigrpstyativdrlfmrnyvvekygrmiptklgidvfrfl
    vrryakfvsedrtrdlesrmdaiergeldylkaledmyaeiksid