PDB entry 1gl5

View 1gl5 on RCSB PDB site
Description: NMR structure of the SH3 domain from the Tec protein tyrosine kinase
Class: transferase
Keywords: transferase, tyrosine-protein kinase, ATP-binding, sh3 domain, phosphorylation
Deposited on 2001-08-28, released 2001-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-28, with a file datestamp of 2018-02-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein kinase tec
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GL5 (0-1)
      • conflict (66)
    • Uniprot P24604 (2-66)
    Domains in SCOPe 2.08: d1gl5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gl5A (A:)
gseivvamydfqateahdlrlergqeyiilekndlhwwrardkygsegyipsnyvtgkks
nnldqyd