PDB entry 1gl4

View 1gl4 on RCSB PDB site
Description: nidogen-1 g2/perlecan ig3 complex
Class: basement membrane
Keywords: basement membrane, immunoglobulin-like domain, extracellular matrix, proteoglycan, heparan sulfate
Deposited on 2001-08-23, released 2001-11-28
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nidogen-1
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1gl4a1, d1gl4a2
  • Chain 'B':
    Compound: basement membrane-specific heparan sulfate proteoglycan core protein
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1gl4b_
  • Heterogens: ZN, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gl4A (A:)
    aplaqqtcannrhqcsvhaecrdyatgfccrcvanytgngrqcvaegspqrvngkvkgri
    fvgssqvpvvfentdlhsyvvmnhgrsytaistipetvgysllplapiggiigwmfaveq
    dgfkngfsitggeftrqaevtflghpgklvlkqqfsgidehghltistelegrvpqipyg
    asvhiepytelyhysssvitssstreytvmepdqdgaapshthiyqwrqtitfqecahdd
    arpalpstqqlsvdsvfvlynkeerilryalsnsigpvrdgspda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl4A (A:)
    tcannrhqcsvhaecrdyatgfccrcvanytgngrqcvaegspqrvngkvkgrifvgssq
    vpvvfentdlhsyvvmnhgrsytaistipetvgysllplapiggiigwmfaveqdgfkng
    fsitggeftrqaevtflghpgklvlkqqfsgidehghltistelegrvpqipygasvhie
    pytelyhysssvitssstreytvmepdqdgaapshthiyqwrqtitfqecahddarpalp
    stqqlsvdsvfvlynkeerilryalsnsigpvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gl4B (B:)
    aplaapskpimvtveeqrsqsvrpgadvtfictakskspaytlvwtrlhngklpsramdf
    ngiltirnvqpsdagtyvctgsnmfamdqgtatlhvqv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl4B (B:)
    pimvtveeqrsqsvrpgadvtfictakskspaytlvwtrlhngklpsramdfngiltirn
    vqpsdagtyvctgsnmfamdqgtatlhvq