PDB entry 1gl4

View 1gl4 on RCSB PDB site
Description: nidogen-1 g2/perlecan ig3 complex
Deposited on 2001-08-23, released 2001-11-28
The last revision prior to the SCOP 1.59 freeze date was dated 2001-11-28, with a file datestamp of 2001-11-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.217
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gl4A (A:)
    tcannrhqcsvhaecrdyatgfccrcvanytgngrqcvaegspqrvngkvkgrifvgssq
    vpvvfentdlhsyvvmnhgrsytaistipetvgysllplapiggiigwmfaveqdgfkng
    fsitggeftrqaevtflghpgklvlkqqfsgidehghltistelegrvpqipygasvhie
    pytelyhysssvitssstreytvmepdqdgaapshthiyqwrqtitfqecahddarpalp
    stqqlsvdsvfvlynkeerilryalsnsigpvr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gl4B (B:)
    pimvtveeqrsqsvrpgadvtfictakskspaytlvwtrlhngklpsramdfngiltirn
    vqpsdagtyvctgsnmfamdqgtatlhvq