PDB entry 1gl1

View 1gl1 on RCSB PDB site
Description: structure of the complex between bovine alpha-chymotrypsin and pmp-c, an inhibitor from the insect locusta migratoria
Class: hydrolase/inhibitor
Keywords: hydrolase/inhibitor, complex (protease/inhibitor), hydrolase, serine protease, serine protease inhibitor
Deposited on 2001-08-22, released 2001-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-chymotrypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gl1a_
  • Chain 'B':
    Compound: alpha-chymotrypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gl1b_
  • Chain 'C':
    Compound: alpha-chymotrypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gl1c_
  • Chain 'I':
    Compound: protease inhibitor lcmi II
    Species: LOCUSTA MIGRATORIA, synthetic [TaxId:7004]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gl1i_
  • Chain 'J':
    Compound: protease inhibitor lcmi II
    Species: LOCUSTA MIGRATORIA, synthetic [TaxId:7004]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gl1j_
  • Chain 'K':
    Compound: protease inhibitor lcmi II
    Species: LOCUSTA MIGRATORIA, synthetic [TaxId:7004]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gl1k_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gl1A (A:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl1A (A:)
    cgvpaiqpvlsgivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
    dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
    psasddfaagttcvttgwgltryntpdrlqqaslpllsntnckkywgtkikdamicagas
    gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gl1B (B:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl1B (B:)
    cgvpaiqpvlsgivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
    dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
    psasddfaagttcvttgwgltryntpdrlqqaslpllsntnckkywgtkikdamicagas
    gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gl1C (C:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl1C (C:)
    cgvpaiqpvlsgivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
    dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
    psasddfaagttcvttgwgltryntpdrlqqaslpllsntnckkywgtkikdamicagas
    gvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1gl1I (I:)
    eiscepgktfkdkcntcrcgadgksaactlkacpnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl1I (I:)
    iscepgktfkdkcntcrcgadgksaactlkacpn
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1gl1J (J:)
    eiscepgktfkdkcntcrcgadgksaactlkacpnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl1J (J:)
    scepgktfkdkcntcrcgadgksaactlkacpn
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1gl1K (K:)
    eiscepgktfkdkcntcrcgadgksaactlkacpnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gl1K (K:)
    scepgktfkdkcntcrcgadgksaactlkacpn